General Information

  • ID:  hor004043
  • Uniprot ID:  A8CL69
  • Protein name:  TSQDITSGMWFGPRL-amide
  • Gene name:  PBAN
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Pyrokinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0016084 myostimulatory hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  TSQDITSGMWFGPRL
  • Length:  15(66-80)
  • Propeptide:  MIGFAVFSSFNRFTTIFVCVLLCVVYLLSYASGEYDGRDSSSGSNNDRAPSNEFGSCTDGKCIKRTSQDITSGMWFGPRLGRRRRADRKPEINSDIEAFANAFEEPHWAIVTIPETEKRQITQFTPRLGRESGEDYFSYGFPKDQEELYTEEQIYLPLFASRLGRRVPWTPSPRLGRQLHNIVDKPRQNFNDPRF
  • Signal peptide:  MIGFAVFSSFNRFTTIFVCVLLCVVYLLSYASG
  • Modification:  T15 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  A hormone that controls sex pheromone production in females and pheromone responsiveness in male. Also mediates visceral muscle contractile activity
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A8CL69-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004043_AF2.pdbhor004043_ESM.pdb

Physical Information

Mass: 194580 Formula: C75H114N20O23S
Absent amino acids: ACEHKNVY Common amino acids: GST
pI: 6.34 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 4
Hydrophobicity: -32 Boman Index: -2174
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 52
Instability Index: 2998.67 Extinction Coefficient cystines: 5500
Absorbance 280nm: 392.86

Literature

  • PubMed ID:  17068263
  • Title:  From the Genome to the Proteome: Uncovering Peptides in the Apis Brain